Lineage for d3ukrg_ (3ukr G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727335Superfamily a.118.13: Arp2/3 complex 16 kDa subunit ARPC5 [69103] (1 family) (S)
    automatically mapped to Pfam PF04699
  5. 2727336Family a.118.13.1: Arp2/3 complex 16 kDa subunit ARPC5 [69104] (2 proteins)
  6. 2727342Protein automated matches [190348] (1 species)
    not a true protein
  7. 2727343Species Cow (Bos taurus) [TaxId:9913] [187175] (14 PDB entries)
  8. 2727344Domain d3ukrg_: 3ukr G: [200997]
    Other proteins in same PDB: d3ukra1, d3ukra2, d3ukrb_, d3ukrc_, d3ukrd1, d3ukrd2, d3ukre_, d3ukrf_
    automated match to d3dxkg_
    complexed with ckh

Details for d3ukrg_

PDB Entry: 3ukr (more details), 2.48 Å

PDB Description: Crystal structure of Bos taurus Arp2/3 complex with bound inhibitor CK-666
PDB Compounds: (G:) Actin-related protein 2/3 complex subunit 5

SCOPe Domain Sequences for d3ukrg_:

Sequence, based on SEQRES records: (download)

>d3ukrg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvgeydenkfvdeedggdgqagpdegevdsclrqgnmtaalqaalknppintks
qavkdragsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqw
hekalaaggvgsivrvltarktv

Sequence, based on observed residues (ATOM records): (download)

>d3ukrg_ a.118.13.1 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
arfrkvdvgeydenkfvdeagpdegevdsclrqgnmtaalqaalknppintksqavkdra
gsivlkvlisfkandiekavqsldkngvdllmkyiykgfespsdnssavllqwhekalaa
ggvgsivrvltarktv

SCOPe Domain Coordinates for d3ukrg_:

Click to download the PDB-style file with coordinates for d3ukrg_.
(The format of our PDB-style files is described here.)

Timeline for d3ukrg_: