Lineage for d3ukrf_ (3ukr F:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212220Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 2212307Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 2212308Family d.198.2.1: Arp2/3 complex subunits [69646] (3 protein domains)
  6. 2212343Protein ARPC4 (20 kDa subunit) [69647] (1 species)
  7. 2212344Species Cow (Bos taurus) [TaxId:9913] [69648] (17 PDB entries)
    Uniprot P59998 # 100% sequence identity
  8. 2212347Domain d3ukrf_: 3ukr F: [193250]
    Other proteins in same PDB: d3ukra1, d3ukra2, d3ukrb_, d3ukrc_, d3ukrd1, d3ukrd2, d3ukre_, d3ukrg_
    automated match to d1k8kf_
    complexed with ckh

Details for d3ukrf_

PDB Entry: 3ukr (more details), 2.48 Å

PDB Description: Crystal structure of Bos taurus Arp2/3 complex with bound inhibitor CK-666
PDB Compounds: (F:) Actin-related protein 2/3 complex subunit 4

SCOPe Domain Sequences for d3ukrf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ukrf_ d.198.2.1 (F:) ARPC4 (20 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
tatlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekv
liegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnf
hteqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf

SCOPe Domain Coordinates for d3ukrf_:

Click to download the PDB-style file with coordinates for d3ukrf_.
(The format of our PDB-style files is described here.)

Timeline for d3ukrf_: