Lineage for d3ukre_ (3ukr E:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735006Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily)
    5 helices; one helix is surrounded by the others
  4. 2735007Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) (S)
    automatically mapped to Pfam PF04062
  5. 2735008Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins)
  6. 2735009Protein Arp2/3 complex 21 kDa subunit ARPC3 [69062] (1 species)
  7. 2735010Species Cow (Bos taurus) [TaxId:9913] [69063] (5 PDB entries)
    Uniprot O15145 # 100% sequence identity
  8. 2735012Domain d3ukre_: 3ukr E: [200996]
    Other proteins in same PDB: d3ukra1, d3ukra2, d3ukrb_, d3ukrc_, d3ukrd1, d3ukrd2, d3ukrf_, d3ukrg_
    automated match to d1k8ke_
    complexed with ckh

Details for d3ukre_

PDB Entry: 3ukr (more details), 2.48 Å

PDB Description: Crystal structure of Bos taurus Arp2/3 complex with bound inhibitor CK-666
PDB Compounds: (E:) Actin-related protein 2/3 complex subunit 3

SCOPe Domain Sequences for d3ukre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ukre_ a.148.1.1 (E:) Arp2/3 complex 21 kDa subunit ARPC3 {Cow (Bos taurus) [TaxId: 9913]}
payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnksls

SCOPe Domain Coordinates for d3ukre_:

Click to download the PDB-style file with coordinates for d3ukre_.
(The format of our PDB-style files is described here.)

Timeline for d3ukre_: