Lineage for d3ukra2 (3ukr A:161-417)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2122051Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2122052Family c.55.1.1: Actin/HSP70 [53068] (8 protein domains)
  6. 2122269Protein Actin-related protein 3, Arp3 [69528] (1 species)
    part of Arp2/3 complex
  7. 2122270Species Cow (Bos taurus) [TaxId:9913] [69529] (16 PDB entries)
    Uniprot P61158
  8. 2122276Domain d3ukra2: 3ukr A:161-417 [200992]
    Other proteins in same PDB: d3ukrb_, d3ukrc_, d3ukrd1, d3ukrd2, d3ukre_, d3ukrf_, d3ukrg_
    automated match to d1k8ka2
    complexed with ckh

Details for d3ukra2

PDB Entry: 3ukr (more details), 2.48 Å

PDB Description: Crystal structure of Bos taurus Arp2/3 complex with bound inhibitor CK-666
PDB Compounds: (A:) Actin-related protein 3

SCOPe Domain Sequences for d3ukra2:

Sequence, based on SEQRES records: (download)

>d3ukra2 c.55.1.1 (A:161-417) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
rtltgtvidsgdgvthvipvaegyvigscikhipiagrdityfiqqllrdrevgippeqs
letakavkerysyvcpdlvkefnkydtdgskwikqytginaiskkefsidvgyerflgpe
iffhpefanpdftqpisevvdeviqncpidvrrplyknivlsggstmfrdfgrrlqrdlk
rtvdarlklseelsggrlkpkpidvqvithhmqryavwfggsmlastpefyqvchtkkdy
eeigpsicrhnpvfgvm

Sequence, based on observed residues (ATOM records): (download)

>d3ukra2 c.55.1.1 (A:161-417) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
rtltgtvidsgdgvthvipvaegyvigscikhipiagrdityfiqqllrdrevgippeqs
letakavkerysyvcpdlvkefnkydtdgskwikqytginaiskkefsidvgyerflgpe
iffhpefanpdftqpisevvdeviqncpidvrrplyknivlsggstmfrdfgrrlqrdlk
rtvdarlklseelskpkpidvqvithhmqryavwfggsmlastpefyqvchtkkdyeeig
psicrhnpvfgvm

SCOPe Domain Coordinates for d3ukra2:

Click to download the PDB-style file with coordinates for d3ukra2.
(The format of our PDB-style files is described here.)

Timeline for d3ukra2: