SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3ukra2 (3ukr A:161-417)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2122051Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2122052Family c.55.1.1: Actin/HSP70 [53068] (8 protein domains)
  6. 2122269Protein Actin-related protein 3, Arp3 [69528] (1 species)
    part of Arp2/3 complex
  7. 2122270Species Cow (Bos taurus) [TaxId:9913] [69529] (16 PDB entries)
    Uniprot P61158
  8. 2122276Domain d3ukra2: 3ukr A:161-417 [200992]
    Other proteins in same PDB: d3ukrb_, d3ukrc_, d3ukrd1, d3ukrd2, d3ukre_, d3ukrf_, d3ukrg_
    automated match to d1k8ka2
    complexed with ckh

Details for d3ukra2

PDB Entry: 3ukr (more details), 2.48 Å

PDB Description: Crystal structure of Bos taurus Arp2/3 complex with bound inhibitor CK-666
PDB Compounds: (A:) Actin-related protein 3

SCOPe Domain Sequences for d3ukra2:

Sequence, based on SEQRES records: (download)

>d3ukra2 c.55.1.1 (A:161-417) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
rtltgtvidsgdgvthvipvaegyvigscikhipiagrdityfiqqllrdrevgippeqs
letakavkerysyvcpdlvkefnkydtdgskwikqytginaiskkefsidvgyerflgpe
iffhpefanpdftqpisevvdeviqncpidvrrplyknivlsggstmfrdfgrrlqrdlk
rtvdarlklseelsggrlkpkpidvqvithhmqryavwfggsmlastpefyqvchtkkdy
eeigpsicrhnpvfgvm

Sequence, based on observed residues (ATOM records): (download)

>d3ukra2 c.55.1.1 (A:161-417) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
rtltgtvidsgdgvthvipvaegyvigscikhipiagrdityfiqqllrdrevgippeqs
letakavkerysyvcpdlvkefnkydtdgskwikqytginaiskkefsidvgyerflgpe
iffhpefanpdftqpisevvdeviqncpidvrrplyknivlsggstmfrdfgrrlqrdlk
rtvdarlklseelskpkpidvqvithhmqryavwfggsmlastpefyqvchtkkdyeeig
psicrhnpvfgvm

SCOPe Domain Coordinates for d3ukra2:

Click to download the PDB-style file with coordinates for d3ukra2.
(The format of our PDB-style files is described here.)

Timeline for d3ukra2: