Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
Domain d3nidl2: 3nid L:108-214 [199948] Other proteins in same PDB: d3nida_, d3nidc_, d3nide_, d3nidf1, d3nidh_, d3nidl1 automated match to d1dqdl2 complexed with ca, gol, mg, nag, so4 |
PDB Entry: 3nid (more details), 2.3 Å
SCOPe Domain Sequences for d3nidl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nidl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d3nidl2: