Lineage for d3nidl2 (3nid L:108-214)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. Protein automated matches [190374] (15 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (649 PDB entries)
  8. Domain d3nidl2: 3nid L:108-214 [199948]
    Other proteins in same PDB: d3nida_, d3nidc_, d3nide_, d3nidf1, d3nidh_, d3nidl1
    automated match to d1dqdl2
    complexed with ca, gol, mg, nag, so4

Details for d3nidl2

PDB Entry: 3nid (more details), 2.3 Å

PDB Description: the closed headpiece of integrin alphaiib beta3 and its complex with an alpahiib beta3 -specific antagonist that does not induce opening
PDB Compounds: (L:) monoclonal antibody 10e5 light chain

SCOPe Domain Sequences for d3nidl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nidl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d3nidl2 are not available.

Timeline for d3nidl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nidl1
View in 3D
Domains from other chains:
(mouse over for more information)
d3nida_, d3nidc_, d3nide_, d3nidf1, d3nidf2, d3nidh_