SCOPe 2.08: Domain d3nidf1: 3nid F:1-107

Lineage for d3nidf1 (3nid F:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3nidf1: 3nid F:1-107 [199945]
   Other proteins in same PDB: d3nida_, d3nidc_, d3nide_, d3nidf2, d3nidh_, d3nidl2
   automated match to d1dqdl1
   complexed with ca, gol, mg, nag, so4

Details for d3nidf1

PDB Entry: 3nid, 2.3 Å

PDB Description: the closed headpiece of integrin alphaiib beta3 and its complex with an alpahiib beta3 -specific antagonist that does not induce opening

PDB Compounds: (F:) monoclonal antibody 10e5 light chain

SCOPe Domain Sequences for d3nidf1:

Sequence; same for both SEQRES and ATOM records:

>d3nidf1 b.1.1.0 (F:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleik

Timeline for d3nidf1:

• d3nidf1 first appeared in SCOPe 2.03
  
• d3nidf1 appears in SCOPe 2.07