PDB entry 3nid

View 3nid on RCSB PDB site
Description: The Closed Headpiece of Integrin alphaIIB beta3 and its Complex with an alpahIIB beta3 -Specific Antagonist That Does Not Induce Opening
Class: cell adhesion/blood clotting
Keywords: Integrin, headpiece, alphaIIB, beta3, CELL ADHESION-BLOOD CLOTTING complex
Deposited on 2010-06-15, released 2010-12-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.179
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: integrin alpha-IIb
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2B, GP2B, ITGAB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nida_
  • Chain 'B':
    Compound: integrin beta-3
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGB3, GP3A
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: integrin alpha-IIb
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGA2B, GP2B, ITGAB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nidc_
  • Chain 'D':
    Compound: integrin beta-3
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGB3, GP3A
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Mmonoclonal antibody 10E5 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NID (0-End)
  • Chain 'F':
    Compound: Mmonoclonal antibody 10E5 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NID (0-213)
    Domains in SCOPe 2.07: d3nidf1, d3nidf2
  • Chain 'H':
    Compound: Mmonoclonal antibody 10E5 heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NID (0-End)
  • Chain 'L':
    Compound: Mmonoclonal antibody 10E5 light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NID (0-213)
    Domains in SCOPe 2.07: d3nidl1, d3nidl2
  • Heterogens: CA, GOL, SO4, MG, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nidA (A:)
    lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
    eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
    eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
    lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
    vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng
    dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
    aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
    lrgavdiddngypdlivgayganqvavyraqpvvkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nidA (A:)
    lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
    eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
    eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
    lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
    vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng
    dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
    aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
    lrgavdiddngypdlivgayganqvavyraqpvv
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nidC (C:)
    lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
    eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
    eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
    lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
    vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng
    dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
    aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
    lrgavdiddngypdlivgayganqvavyraqpvvkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nidC (C:)
    lnldpvqltfyagpngsqfgfsldfhkdshgrvaivvgaprtlgpsqeetggvflcpwra
    eggqcpsllfdlrdetrnvgsqtlqtfkarqglgasvvswsdvivacapwqhwnvlekte
    eaektpvgscflaqpesgrraeyspcrgntlsriyvendfswdkryceagfssvvtqage
    lvlgapggyyflgllaqapvadifssyrpgillwhvssqslsfdssnpeyfdgywgysva
    vgefdgdlntteyvvgaptwswtlgaveildsyyqrlhrlrgeqmasyfghsvavtdvng
    dgrhdllvgaplymesradrklaevgrvylflqprgphalgapsllltgtqlygrfgsai
    aplgdldrdgyndiavaapyggpsgrgqvlvflgqseglrsrpsqvldspfptgsafgfs
    lrgavdiddngypdlivgayganqvavyraqpv
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nidF (F:)
    dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
    rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nidL (L:)
    dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
    rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec