Lineage for d3nide_ (3nid E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744518Domain d3nide_: 3nid E: [408539]
    Other proteins in same PDB: d3nida_, d3nidc_, d3nidf1, d3nidf2, d3nidl1, d3nidl2
    automated match to d6shgh_
    complexed with ca, gol, mg, nag, so4

Details for d3nide_

PDB Entry: 3nid (more details), 2.3 Å

PDB Description: the closed headpiece of integrin alphaiib beta3 and its complex with an alpahiib beta3 -specific antagonist that does not induce opening
PDB Compounds: (E:) monoclonal antibody 10e5 heavy chain

SCOPe Domain Sequences for d3nide_:

Sequence, based on SEQRES records: (download)

>d3nide_ b.1.1.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaelvkpgasvklsctasgfnikdtyvhwvkqrpeqglewigridpangytky
dpkfqgkatitadtssntaylqlssltsedtavyycvrplydyyamdywgqgtsvtvssa
kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records): (download)

>d3nide_ b.1.1.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqqsgaelvkpgasvklsctasgfnikdtyvhwvkqrpeqglewigridpangytky
dpkfqgkatitadtssntaylqlssltsedtavyycvrplydyyamdywgqgtsvtvssa
kttapsvyplapvcssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss
svtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOPe Domain Coordinates for d3nide_:

Click to download the PDB-style file with coordinates for d3nide_.
(The format of our PDB-style files is described here.)

Timeline for d3nide_:

  • d3nide_ is new in SCOPe 2.08-stable