Lineage for d3nidl1 (3nid L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759989Domain d3nidl1: 3nid L:1-107 [199947]
    Other proteins in same PDB: d3nida_, d3nidc_, d3nide_, d3nidf2, d3nidh_, d3nidl2
    automated match to d1dqdl1
    complexed with ca, gol, mg, nag, so4

Details for d3nidl1

PDB Entry: 3nid (more details), 2.3 Å

PDB Description: the closed headpiece of integrin alphaiib beta3 and its complex with an alpahiib beta3 -specific antagonist that does not induce opening
PDB Compounds: (L:) monoclonal antibody 10e5 light chain

SCOPe Domain Sequences for d3nidl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nidl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilmtqspssmsvslgdtvsitchasqgissnigwlqqkpgksfmgliyygtnlvdgvps
rfsgsgsgadysltissldsedfadyycvqyaqlpytfgggtkleik

SCOPe Domain Coordinates for d3nidl1:

Click to download the PDB-style file with coordinates for d3nidl1.
(The format of our PDB-style files is described here.)

Timeline for d3nidl1: