Lineage for d3nidl2 (3nid L:108-214)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1290587Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1294263Protein automated matches [190374] (12 species)
    not a true protein
  7. 1294862Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries)
  8. 1294997Domain d3nidl2: 3nid L:108-214 [199948]
    Other proteins in same PDB: d3nida_, d3nidc_, d3nidf1, d3nidl1
    automated match to d1dqdl2
    complexed with ca, gol, mg, nag, so4

Details for d3nidl2

PDB Entry: 3nid (more details), 2.3 Å

PDB Description: the closed headpiece of integrin alphaiib beta3 and its complex with an alpahiib beta3 -specific antagonist that does not induce opening
PDB Compounds: (L:) Mmonoclonal antibody 10E5 light chain

SCOPe Domain Sequences for d3nidl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nidl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d3nidl2:

Click to download the PDB-style file with coordinates for d3nidl2.
(The format of our PDB-style files is described here.)

Timeline for d3nidl2: