SCOPe 2.03: Domain d3nidl2: 3nid L:108-214

Lineage for d3nidl2 (3nid L:108-214)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries)

8. Domain d3nidl2: 3nid L:108-214 [199948]
   Other proteins in same PDB: d3nida_, d3nidc_, d3nidf1, d3nidl1
   automated match to d1dqdl2
   complexed with ca, gol, mg, nag, so4

Details for d3nidl2

PDB Entry: 3nid, 2.3 Å

PDB Description: the closed headpiece of integrin alphaiib beta3 and its complex with an alpahiib beta3 -specific antagonist that does not induce opening

PDB Compounds: (L:) Mmonoclonal antibody 10E5 light chain

SCOPe Domain Sequences for d3nidl2:

Sequence; same for both SEQRES and ATOM records:

>d3nidl2 b.1.1.2 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d3nidl2:

• d3nidl2 is new in SCOPe 2.03-stable
  
• d3nidl2 appears in SCOPe 2.04
  
• d3nidl2 appears in the current release, SCOPe 2.08