Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Fab KOL (human), lambda L chain [48767] (2 PDB entries) |
Domain d2ig2h1: 2ig2 H:1-119 [19849] Other proteins in same PDB: d2ig2h2, d2ig2l2 intact protein but only Fab's can be seen |
PDB Entry: 2ig2 (more details), 3 Å
SCOP Domain Sequences for d2ig2h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ig2h1 b.1.1.1 (H:1-119) Immunoglobulin (variable domains of L and H chains) {Fab KOL (human), lambda L chain} evqlvqsgggvvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhy adsvkgrftisrndskntlflqmdslrpedtgvyfcardgghgfcssascfgpdywgqgt pvtvssa
Timeline for d2ig2h1: