SCOPe 2.08: Domain d2ig2h1: 2ig2 H:1-119

Lineage for d2ig2h1 (2ig2 H:1-119)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (30 PDB entries)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)

8. Domain d2ig2h1: 2ig2 H:1-119 [19849]
   Other proteins in same PDB: d2ig2h2, d2ig2l1, d2ig2l2
   part of antibody KOL; intact protein but only Fab's can be seen in the crystal structure

Details for d2ig2h1

PDB Entry: 2ig2, 3 Å

PDB Description: dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. ii. aminosaeuresequenz der l-kette, lambda- typ, subgruppe i (german)

PDB Compounds: (H:) igg1-lambda kol fab (heavy chain)

SCOPe Domain Sequences for d2ig2h1:

Sequence; same for both SEQRES and ATOM records:

>d2ig2h1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
evqlvqsgggvvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhy
adsvkgrftisrndskntlflqmdslrpedtgvyfcardgghgfcssascfgpdywgqgt
pvtvssa

Timeline for d2ig2h1:

• d2ig2h1 first appeared (with stable ids) in SCOP 1.55
  
• d2ig2h1 appears in SCOPe 2.07