Lineage for d2ig2h2 (2ig2 H:120-231)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221587Species Fab KOL (human), lambda L chain [48988] (2 PDB entries)
  8. 221590Domain d2ig2h2: 2ig2 H:120-231 [20953]
    Other proteins in same PDB: d2ig2h1, d2ig2l1
    intact protein but only Fab's can be seen

Details for d2ig2h2

PDB Entry: 2ig2 (more details), 3 Å

PDB Description: dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. ii. aminosaeuresequenz der l-kette, lambda- typ, subgruppe i (german)

SCOP Domain Sequences for d2ig2h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ig2h2 b.1.1.2 (H:120-231) Immunoglobulin (constant domains of L and H chains) {Fab KOL (human), lambda L chain}
stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg
lyslssvvtvpssslgtqtyicnvnhkpsntkvdkrvepkscdkthtcppcp

SCOP Domain Coordinates for d2ig2h2:

Click to download the PDB-style file with coordinates for d2ig2h2.
(The format of our PDB-style files is described here.)

Timeline for d2ig2h2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ig2h1