Lineage for d2ig2h1 (2ig2 H:1-119)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158263Species Fab KOL (human), lambda L chain [48767] (2 PDB entries)
  8. 158266Domain d2ig2h1: 2ig2 H:1-119 [19849]
    Other proteins in same PDB: d2ig2h2, d2ig2l2

Details for d2ig2h1

PDB Entry: 2ig2 (more details), 3 Å

PDB Description: dir primaerstruktur des kristallisierbaren monoklonalen immunoglobulins igg1 kol. ii. aminosaeuresequenz der l-kette, lambda- typ, subgruppe i (german)

SCOP Domain Sequences for d2ig2h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ig2h1 b.1.1.1 (H:1-119) Immunoglobulin (variable domains of L and H chains) {Fab KOL (human), lambda L chain}
evqlvqsgggvvqpgrslrlscsssgfifssyamywvrqapgkglewvaiiwddgsdqhy
adsvkgrftisrndskntlflqmdslrpedtgvyfcardgghgfcssascfgpdywgqgt
pvtvssa

SCOP Domain Coordinates for d2ig2h1:

Click to download the PDB-style file with coordinates for d2ig2h1.
(The format of our PDB-style files is described here.)

Timeline for d2ig2h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ig2h2