Class a: All alpha proteins [46456] (285 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein automated matches [193445] (6 species) not a true protein |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [225181] (3 PDB entries) |
Domain d2hueb_: 2hue B: [198026] Other proteins in same PDB: d2huea1, d2huec_ automated match to d2io5b_ complexed with gol, so4, zn |
PDB Entry: 2hue (more details), 1.7 Å
SCOPe Domain Sequences for d2hueb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hueb_ a.22.1.1 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} alirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvti mpkdiqlarrirger
Timeline for d2hueb_: