SCOPe 2.08: Domain d2hueb1: 2hue B:61-134

Lineage for d2hueb1 (2hue B:61-134)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein automated matches [193445] (8 species)
   not a true protein

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [225181] (11 PDB entries)

8. Domain d2hueb1: 2hue B:61-134 [198026]
   Other proteins in same PDB: d2huea1, d2huea2, d2hueb2, d2huec_
   automated match to d2io5b_
   complexed with gol, so4, zn

Details for d2hueb1

PDB Entry: 2hue, 1.7 Å

PDB Description: structure of the h3-h4 chaperone asf1 bound to histones h3 and h4

PDB Compounds: (B:) histone h3

SCOPe Domain Sequences for d2hueb1:

Sequence; same for both SEQRES and ATOM records:

>d2hueb1 a.22.1.1 (B:61-134) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
pkdiqlarrirger

Timeline for d2hueb1:

• d2hueb1 first appeared in SCOPe 2.03, called d2hueb_
  
• d2hueb1 appears in SCOPe 2.07