PDB entry 2hue

View 2hue on RCSB PDB site
Description: Structure of the H3-H4 chaperone Asf1 bound to histones H3 and H4
Class: DNA binding protein
Keywords: mini beta sheet, elongated Beta sandwhich, DNA BINDING PROTEIN
Deposited on 2006-07-26, released 2006-11-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.209
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Anti-silencing protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ASF1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32447 (7-End)
      • cloning artifact (6)
    Domains in SCOPe 2.04: d2huea1
  • Chain 'B':
    Compound: histone h3
    Species: Xenopus laevis [TaxId:8355]
    Gene: H3l
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92133 (2-End)
      • cloning artifact (1)
      • engineered (43)
      • see remark 999 (52)
    Domains in SCOPe 2.04: d2hueb_
  • Chain 'C':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2huec_
  • Heterogens: SO4, ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hueA (A:)
    plgspnssivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhd
    qeldsilvgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvn
    neydeeelrenppakvqvdhivrnilaekprvtrfnivwdnenegdlyppeqpgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hueA (A:)
    ssivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsi
    lvgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydee
    elrenppakvqvdhivrnilaekprvtrfnivwdnenegdlypp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hueB (B:)
    malirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvt
    impkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hueB (B:)
    alirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvti
    mpkdiqlarrirger
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hueC (C:)
    mkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr
    ktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hueC (C:)
    kvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrk
    tvtamdvvyalkrqgrtlygfg