Lineage for d3d48p_ (3d48 P:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1486907Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 1486908Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 1486909Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 1486978Protein Prolactin (placental lactogen) [47278] (2 species)
  7. 1486979Species Human (Homo sapiens) [TaxId:9606] [89035] (3 PDB entries)
  8. 1486980Domain d3d48p_: 3d48 P: [195459]
    Other proteins in same PDB: d3d48r1, d3d48r2
    automated match to d2q98a_
    complexed with co3

Details for d3d48p_

PDB Entry: 3d48 (more details), 2.5 Å

PDB Description: crystal structure of a prolactin receptor antagonist bound to the extracellular domain of the prolactin receptor
PDB Compounds: (P:) Prolactin

SCOPe Domain Sequences for d3d48p_:

Sequence, based on SEQRES records: (download)

>d3d48p_ a.26.1.1 (P:) Prolactin (placental lactogen) {Human (Homo sapiens) [TaxId: 9606]}
vtlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainschtsslatpedkeqa
qqmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveieeqtkrllermel
ivsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdshkidnylkllkcr
iihnnn

Sequence, based on observed residues (ATOM records): (download)

>d3d48p_ a.26.1.1 (P:) Prolactin (placental lactogen) {Human (Homo sapiens) [TaxId: 9606]}
vtlrdlfdravvlshyihnlssemfsefdkgfitkainschtsslatpedkeqaqqmnqk
dflslivsilrswneplyhlvtevrailskaveieeqtkrllermelivsqviypvwsgl
pslqmadeesrlsayynllhclrrdshkidnylkllkcriihnnn

SCOPe Domain Coordinates for d3d48p_:

Click to download the PDB-style file with coordinates for d3d48p_.
(The format of our PDB-style files is described here.)

Timeline for d3d48p_: