SCOPe 2.08: Domain d3d48p_: 3d48 P:

Lineage for d3d48p_ (3d48 P:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)

6. Protein Prolactin (placental lactogen) [47278] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89035] (4 PDB entries)

8. Domain d3d48p_: 3d48 P: [195459]
   Other proteins in same PDB: d3d48r1, d3d48r2
   automated match to d2q98a_
   complexed with co3

Details for d3d48p_

PDB Entry: 3d48, 2.5 Å

PDB Description: crystal structure of a prolactin receptor antagonist bound to the extracellular domain of the prolactin receptor

PDB Compounds: (P:) Prolactin

SCOPe Domain Sequences for d3d48p_:

Sequence, based on SEQRES records:

>d3d48p_ a.26.1.1 (P:) Prolactin (placental lactogen) {Human (Homo sapiens) [TaxId: 9606]}
vtlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainschtsslatpedkeqa
qqmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveieeqtkrllermel
ivsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdshkidnylkllkcr
iihnnn

Sequence, based on observed residues (ATOM records):

>d3d48p_ a.26.1.1 (P:) Prolactin (placental lactogen) {Human (Homo sapiens) [TaxId: 9606]}
vtlrdlfdravvlshyihnlssemfsefdkgfitkainschtsslatpedkeqaqqmnqk
dflslivsilrswneplyhlvtevrailskaveieeqtkrllermelivsqviypvwsgl
pslqmadeesrlsayynllhclrrdshkidnylkllkcriihnnn

Timeline for d3d48p_:

• d3d48p_ first appeared in SCOPe 2.02
  
• d3d48p_ appears in SCOPe 2.07