Class a: All alpha proteins [46456] (284 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
Protein Prolactin (placental lactogen) [47278] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [89035] (3 PDB entries) |
Domain d3d48p_: 3d48 P: [195459] Other proteins in same PDB: d3d48r1, d3d48r2 automated match to d2q98a_ complexed with co3 |
PDB Entry: 3d48 (more details), 2.5 Å
SCOPe Domain Sequences for d3d48p_:
Sequence, based on SEQRES records: (download)
>d3d48p_ a.26.1.1 (P:) Prolactin (placental lactogen) {Human (Homo sapiens) [TaxId: 9606]} vtlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainschtsslatpedkeqa qqmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveieeqtkrllermel ivsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdshkidnylkllkcr iihnnn
>d3d48p_ a.26.1.1 (P:) Prolactin (placental lactogen) {Human (Homo sapiens) [TaxId: 9606]} vtlrdlfdravvlshyihnlssemfsefdkgfitkainschtsslatpedkeqaqqmnqk dflslivsilrswneplyhlvtevrailskaveieeqtkrllermelivsqviypvwsgl pslqmadeesrlsayynllhclrrdshkidnylkllkcriihnnn
Timeline for d3d48p_: