SCOPe 2.04: Domain d3d48r2: 3d48 R:101-204

Lineage for d3d48r2 (3d48 R:101-204)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein automated matches [190888] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188282] (24 PDB entries)

8. Domain d3d48r2: 3d48 R:101-204 [157290]
   Other proteins in same PDB: d3d48p_
   automated match to d3mzgb2
   complexed with co3

Details for d3d48r2

PDB Entry: 3d48, 2.5 Å

PDB Description: crystal structure of a prolactin receptor antagonist bound to the extracellular domain of the prolactin receptor

PDB Compounds: (R:) Prolactin receptor

SCOPe Domain Sequences for d3d48r2:

Sequence, based on SEQRES records:

>d3d48r2 b.1.2.1 (R:101-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqpdpplelavevkqpedrkpylwikwspptlidlktgwftllyeirlkpekaaeweihf
agqqtefkilslhpgqkylvqvrckpdhgywsawspatfiqips

Sequence, based on observed residues (ATOM records):

>d3d48r2 b.1.2.1 (R:101-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vqpdpplelavevkpylwikwspptlidlktgwftllyeirlkpekaaeweihfagqqte
fkilspgqkylvqvrckpdhgywsawspatfiqips

Timeline for d3d48r2:

• d3d48r2 first appeared in SCOP 1.75
  
• d3d48r2 appears in SCOPe 2.03
  
• d3d48r2 appears in SCOPe 2.05
  
• d3d48r2 appears in the current release, SCOPe 2.08