Class a: All alpha proteins [46456] (285 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.1: Long-chain cytokines [47267] (10 proteins) |
Protein Prolactin (placental lactogen) [47278] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [89035] (3 PDB entries) |
Domain d2q98a_: 2q98 A: [167483] automated match to d1n9da_ |
PDB Entry: 2q98 (more details), 2.7 Å
SCOPe Domain Sequences for d2q98a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q98a_ a.26.1.1 (A:) Prolactin (placental lactogen) {Human (Homo sapiens) [TaxId: 9606]} mrsqvtlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainschtsslatped keqaqqmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveieeqtkrlle rmelivsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdshkidnylkl lkcriihnnnc
Timeline for d2q98a_: