| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (3 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
| Family a.26.1.1: Long-chain cytokines [47267] (9 proteins) |
| Protein Prolactin (placental lactogen) [47278] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89035] (2 PDB entries) |
| Domain d1n9da_: 1n9d A: [85464] |
PDB Entry: 1n9d (more details)
SCOP Domain Sequences for d1n9da_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n9da_ a.26.1.1 (A:) Prolactin (placental lactogen) {Human (Homo sapiens) [TaxId: 9606]}
lpicpggaarcqvtlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainscht
sslatpedkeqaqqmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveie
eqtkrllegmelivsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdsh
kidnylkllkcriihnnnc
Timeline for d1n9da_: