PDB entry 1n9d

View 1n9d on RCSB PDB site
Description: solution structure of human prolactin
Class: hormone/growth factor
Keywords: four alpha-helical bundle
Deposited on 2002-11-23, released 2003-05-06
The last revision prior to the SCOP 1.75 freeze date was dated 2003-05-13, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prolactin
    Species: HOMO SAPIENS
    Gene: PRL
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1n9da_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1n9dA (A:)
lpicpggaarcqvtlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainscht
sslatpedkeqaqqmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveie
eqtkrllegmelivsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdsh
kidnylkllkcriihnnnc