Lineage for d2q98a1 (2q98 A:10-199)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705449Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)
  6. 2705520Protein Prolactin (placental lactogen) [47278] (2 species)
  7. 2705521Species Human (Homo sapiens) [TaxId:9606] [89035] (4 PDB entries)
  8. 2705522Domain d2q98a1: 2q98 A:10-199 [167483]
    Other proteins in same PDB: d2q98a2
    automated match to d1n9da_

Details for d2q98a1

PDB Entry: 2q98 (more details), 2.7 Å

PDB Description: x-ray structure of a prolactin antagonist
PDB Compounds: (A:) Prolactin

SCOPe Domain Sequences for d2q98a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q98a1 a.26.1.1 (A:10-199) Prolactin (placental lactogen) {Human (Homo sapiens) [TaxId: 9606]}
rsqvtlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainschtsslatpedk
eqaqqmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveieeqtkrller
melivsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdshkidnylkll
kcriihnnnc

SCOPe Domain Coordinates for d2q98a1:

Click to download the PDB-style file with coordinates for d2q98a1.
(The format of our PDB-style files is described here.)

Timeline for d2q98a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q98a2