SCOPe 2.08: Domain d2q98a1: 2q98 A:10-199

Lineage for d2q98a1 (2q98 A:10-199)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.1: Long-chain cytokines [47267] (10 proteins)

6. Protein Prolactin (placental lactogen) [47278] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89035] (4 PDB entries)

8. Domain d2q98a1: 2q98 A:10-199 [167483]
   Other proteins in same PDB: d2q98a2
   automated match to d1n9da_

Details for d2q98a1

PDB Entry: 2q98, 2.7 Å

PDB Description: x-ray structure of a prolactin antagonist

PDB Compounds: (A:) Prolactin

SCOPe Domain Sequences for d2q98a1:

Sequence; same for both SEQRES and ATOM records:

>d2q98a1 a.26.1.1 (A:10-199) Prolactin (placental lactogen) {Human (Homo sapiens) [TaxId: 9606]}
rsqvtlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainschtsslatpedk
eqaqqmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveieeqtkrller
melivsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdshkidnylkll
kcriihnnnc

Timeline for d2q98a1:

• d2q98a1 first appeared in SCOPe 2.01, called d2q98a_
  
• d2q98a1 appears in SCOPe 2.07