PDB entry 2q98

View 2q98 on RCSB PDB site
Description: X-ray structure of a prolactin antagonist
Class: hormone
Keywords: antagonist receptor interaction, HORMONE
Deposited on 2007-06-12, released 2007-09-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-05-19, with a file datestamp of 2010-05-14.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.221
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prolactin
    Species: Homo sapiens [TaxId:9606]
    Gene: PRL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01236 (1-190)
      • expression tag (0)
      • engineered (2)
      • engineered (120)
    Domains in SCOPe 2.04: d2q98a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2q98A (A:)
mrsqvtlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainschtsslatped
keqaqqmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveieeqtkrlle
rmelivsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdshkidnylkl
lkcriihnnnc