SCOPe 2.02: Domain d4hx3k_: 4hx3 K:

Lineage for d4hx3k_ (4hx3 K:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.1: Zinc protease [55487] (2 proteins)
   single domain

6. Protein automated matches [194246] (1 species)
   not a true protein

7. Species Streptomyces caespitosus [TaxId:53502] [194247] (1 PDB entry)

8. Domain d4hx3k_: 4hx3 K: [194248]
   Other proteins in same PDB: d4hx3d_, d4hx3l_
   automated match to d1c7ka_
   complexed with gol, zn

Details for d4hx3k_

PDB Entry: 4hx3, 2.7 Å

PDB Description: crystal structure of streptomyces caespitosus sermetstatin in complex with s. caespitosus snapalysin

PDB Compounds: (K:) Extracellular small neutral protease

SCOPe Domain Sequences for d4hx3k_:

Sequence; same for both SEQRES and ATOM records:

>d4hx3k_ d.92.1.1 (K:) automated matches {Streptomyces caespitosus [TaxId: 53502]}
pmvtvtydpsnapsfqqeianaaqiwnssvrnvqlraggnadfsyyegndsrgsyaqtdg
hgrgyifldyqqnqqydstrvtahetghvlglpdhyqgpcselmsgggpgpsctnpypna
qersrvnalwang

Timeline for d4hx3k_:

• d4hx3k_ is new in SCOPe 2.02-stable
  
• d4hx3k_ appears in SCOPe 2.03
  
• d4hx3k_ appears in the current release, SCOPe 2.08, called d4hx3k1