PDB entry 4hx3

View 4hx3 on RCSB PDB site
Description: Crystal structure of Streptomyces caespitosus sermetstatin in complex with S. caespitosus snapalysin
Class: Hydrolase/Hydrolase Inhibitor
Keywords: Streptomyces subtilisin inhibitor fold, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2012-11-09, released 2012-12-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2013-02-27, with a file datestamp of 2013-02-22.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.196
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Extracellular small neutral protease
  Species: Streptomyces caespitosus [TaxId:53502]
  Gene: snpA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56406 (3-133)
    • expression tag (0-2)
    • expression tag (1)
• Chain 'B':
  Compound: Neutral proteinase inhibitor ScNPI
  Species: Streptomyces caespitosus [TaxId:53502]
  Gene: ScNPI
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9FDS0 (1-113)
• Chain 'C':
  Compound: Extracellular small neutral protease
  Species: Streptomyces caespitosus [TaxId:53502]
  Gene: snpA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56406 (3-133)
    • expression tag (0-2)
    • expression tag (1)
• Chain 'D':
  Compound: Neutral proteinase inhibitor ScNPI
  Species: Streptomyces caespitosus [TaxId:53502]
  Gene: ScNPI
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9FDS0 (1-113)
  Domains in SCOPe 2.02: d4hx3d_
• Chain 'E':
  Compound: Extracellular small neutral protease
  Species: Streptomyces caespitosus [TaxId:53502]
  Gene: snpA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56406 (3-133)
    • expression tag (2)
• Chain 'F':
  Compound: Neutral proteinase inhibitor ScNPI
  Species: Streptomyces caespitosus [TaxId:53502]
  Gene: ScNPI
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9FDS0 (Start-113)
• Chain 'G':
  Compound: Extracellular small neutral protease
  Species: Streptomyces caespitosus [TaxId:53502]
  Gene: snpA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56406 (3-133)
    • expression tag (1-2)
    • expression tag (1)
• Chain 'H':
  Compound: Neutral proteinase inhibitor ScNPI
  Species: Streptomyces caespitosus [TaxId:53502]
  Gene: ScNPI
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9FDS0 (1-113)
    • expression tag (0)
• Chain 'I':
  Compound: Extracellular small neutral protease
  Species: Streptomyces caespitosus [TaxId:53502]
  Gene: snpA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56406 (3-133)
    • expression tag (0-2)
    • expression tag (1)
  Domains in SCOPe 2.02: d4hx3i_
• Chain 'J':
  Compound: Neutral proteinase inhibitor ScNPI
  Species: Streptomyces caespitosus [TaxId:53502]
  Gene: ScNPI
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9FDS0 (1-113)
• Chain 'K':
  Compound: Extracellular small neutral protease
  Species: Streptomyces caespitosus [TaxId:53502]
  Gene: snpA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P56406 (3-133)
    • expression tag (1-2)
    • expression tag (1)
  Domains in SCOPe 2.02: d4hx3k_
• Chain 'L':
  Compound: Neutral proteinase inhibitor ScNPI
  Species: Streptomyces caespitosus [TaxId:53502]
  Gene: ScNPI
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9FDS0 (1-113)
  Domains in SCOPe 2.02: d4hx3l_
• Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >4hx3D (D:)
  gsahgpsamvftviqgsgeptdtvlrattlscaytaegthpapraacdalnatdgelnrl
  laapdpslvcpmyfdpvtvtadgvlngrrvawkhtfsntcvmsanlnsnpvyaf
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4hx3D (D:)
  sahgpsamvftviqgsgeptdtvlrattlscaytaegthpapraacdalnatdgelnrll
  aalvcpmyfdpvtvtadgvlngrrvawkhtfsntcvmsanlnsnpvyaf
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  No sequence available.
  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4hx3I (I:)
  gpmvtvtydpsnapsfqqeianaaqiwnssvrnvqlraggnadfsyyegndsrgsyaqtd
  ghgrgyifldyqqnqqydstrvtahetghvlglpdhyqgpcselmsgggpgpsctnpypn
  aqersrvnalwang
  

  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  Sequence, based on SEQRES records: (download)
  

  >4hx3K (K:)
  gpmvtvtydpsnapsfqqeianaaqiwnssvrnvqlraggnadfsyyegndsrgsyaqtd
  ghgrgyifldyqqnqqydstrvtahetghvlglpdhyqgpcselmsgggpgpsctnpypn
  aqersrvnalwang
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4hx3K (K:)
  pmvtvtydpsnapsfqqeianaaqiwnssvrnvqlraggnadfsyyegndsrgsyaqtdg
  hgrgyifldyqqnqqydstrvtahetghvlglpdhyqgpcselmsgggpgpsctnpypna
  qersrvnalwang
  

  
  
• Chain 'L':
  Sequence, based on SEQRES records: (download)
  

  >4hx3L (L:)
  gsahgpsamvftviqgsgeptdtvlrattlscaytaegthpapraacdalnatdgelnrl
  laapdpslvcpmyfdpvtvtadgvlngrrvawkhtfsntcvmsanlnsnpvyaf
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4hx3L (L:)
  sahgpsamvftviqgsgeptdtvlrattlscaytaegthpapraacdalnatdgelnrll
  aapdpslvcpmyfdpvtvtadgvlngrrvawkhtfsntcvmsanlnsnpvyaf