Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.84: Subtilisin inhibitor [55398] (1 superfamily) alpha+beta sandwich |
Superfamily d.84.1: Subtilisin inhibitor [55399] (2 families) |
Family d.84.1.0: automated matches [193339] (1 protein) not a true family |
Protein automated matches [193340] (2 species) not a true protein |
Species Streptomyces caespitosus [TaxId:53502] [193341] (1 PDB entry) |
Domain d4hx3l_: 4hx3 L: [193344] Other proteins in same PDB: d4hx3i_, d4hx3k_ automated match to d2sici_ complexed with gol, zn |
PDB Entry: 4hx3 (more details), 2.7 Å
SCOPe Domain Sequences for d4hx3l_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hx3l_ d.84.1.0 (L:) automated matches {Streptomyces caespitosus [TaxId: 53502]} sahgpsamvftviqgsgeptdtvlrattlscaytaegthpapraacdalnatdgelnrll aapdpslvcpmyfdpvtvtadgvlngrrvawkhtfsntcvmsanlnsnpvyaf
Timeline for d4hx3l_: