Lineage for d4hx3d_ (4hx3 D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1211251Fold d.84: Subtilisin inhibitor [55398] (1 superfamily)
    alpha+beta sandwich
  4. 1211252Superfamily d.84.1: Subtilisin inhibitor [55399] (2 families) (S)
  5. 1211262Family d.84.1.0: automated matches [193339] (1 protein)
    not a true family
  6. 1211263Protein automated matches [193340] (2 species)
    not a true protein
  7. 1211264Species Streptomyces caespitosus [TaxId:53502] [193342] (1 PDB entry)
  8. 1211265Domain d4hx3d_: 4hx3 D: [193343]
    Other proteins in same PDB: d4hx3i_, d4hx3k_
    automated match to d2sici_
    complexed with gol, zn

Details for d4hx3d_

PDB Entry: 4hx3 (more details), 2.7 Å

PDB Description: crystal structure of streptomyces caespitosus sermetstatin in complex with s. caespitosus snapalysin
PDB Compounds: (D:) Neutral proteinase inhibitor ScNPI

SCOPe Domain Sequences for d4hx3d_:

Sequence, based on SEQRES records: (download)

>d4hx3d_ d.84.1.0 (D:) automated matches {Streptomyces caespitosus [TaxId: 53502]}
sahgpsamvftviqgsgeptdtvlrattlscaytaegthpapraacdalnatdgelnrll
aapdpslvcpmyfdpvtvtadgvlngrrvawkhtfsntcvmsanlnsnpvyaf

Sequence, based on observed residues (ATOM records): (download)

>d4hx3d_ d.84.1.0 (D:) automated matches {Streptomyces caespitosus [TaxId: 53502]}
sahgpsamvftviqgsgeptdtvlrattlscaytaegthpapraacdalnatdgelnrll
aalvcpmyfdpvtvtadgvlngrrvawkhtfsntcvmsanlnsnpvyaf

SCOPe Domain Coordinates for d4hx3d_:

Click to download the PDB-style file with coordinates for d4hx3d_.
(The format of our PDB-style files is described here.)

Timeline for d4hx3d_: