Lineage for d4f4oj_ (4f4o J:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686238Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2686985Species Pig (Sus scrofa) [TaxId:9823] [46491] (3 PDB entries)
  8. 2686993Domain d4f4oj_: 4f4o J: [192420]
    Other proteins in same PDB: d4f4ob_, d4f4oe_, d4f4oh_, d4f4ok_
    automated match to d1qpwa_
    complexed with hem, nag, oxy

Details for d4f4oj_

PDB Entry: 4f4o (more details), 2.9 Å

PDB Description: structure of the haptoglobin-haemoglobin complex
PDB Compounds: (J:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d4f4oj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f4oj_ a.1.1.2 (J:) Hemoglobin, alpha-chain {Pig (Sus scrofa) [TaxId: 9823]}
vlsaadkanvkaawgkvggqagahgaealermflgfpttktyfphfnlshgsdqvkahgq
kvadaltkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlaahhpddfnps
vhasldkflanvstvltskyr

SCOPe Domain Coordinates for d4f4oj_:

Click to download the PDB-style file with coordinates for d4f4oj_.
(The format of our PDB-style files is described here.)

Timeline for d4f4oj_: