![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, alpha-chain [46486] (24 species) |
![]() | Species Pig (Sus scrofa) [TaxId:9823] [46491] (3 PDB entries) |
![]() | Domain d4f4og_: 4f4o G: [192419] Other proteins in same PDB: d4f4ob_, d4f4oe_, d4f4oh_, d4f4ok_ automated match to d1qpwa_ complexed with hem, nag, oxy |
PDB Entry: 4f4o (more details), 2.9 Å
SCOPe Domain Sequences for d4f4og_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f4og_ a.1.1.2 (G:) Hemoglobin, alpha-chain {Pig (Sus scrofa) [TaxId: 9823]} vlsaadkanvkaawgkvggqagahgaealermflgfpttktyfphfnlshgsdqvkahgq kvadaltkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlaahhpddfnps vhasldkflanvstvltskyr
Timeline for d4f4og_: