Lineage for d4f4ok_ (4f4o K:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687001Protein Hemoglobin, beta-chain [46500] (26 species)
  7. 2687757Species Pig (Sus scrofa) [TaxId:9823] [46507] (3 PDB entries)
  8. 2687765Domain d4f4ok_: 4f4o K: [234411]
    Other proteins in same PDB: d4f4oa_, d4f4od_, d4f4og_, d4f4oj_
    automated match to d1qpwb_
    complexed with hem, nag, oxy

Details for d4f4ok_

PDB Entry: 4f4o (more details), 2.9 Å

PDB Description: structure of the haptoglobin-haemoglobin complex
PDB Compounds: (K:) Hemoglobin subunit beta

SCOPe Domain Sequences for d4f4ok_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4f4ok_ a.1.1.2 (K:) Hemoglobin, beta-chain {Pig (Sus scrofa) [TaxId: 9823]}
vhlsaeekeavlglwgkvnvdevggealgrllvvypwtqrffesfgdlsnadavmgnpkv
kahgkkvlqsfsdglkhldnlkgtfaklselhcdqlhvdpenfrllgnvivvvlarrlgh
dfnpnvqaafqkvvagvanalahkyh

SCOPe Domain Coordinates for d4f4ok_:

Click to download the PDB-style file with coordinates for d4f4ok_.
(The format of our PDB-style files is described here.)

Timeline for d4f4ok_: