| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Hemoglobin, beta-chain [46500] (26 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [46507] (3 PDB entries) |
| Domain d4f4ob_: 4f4o B: [234409] Other proteins in same PDB: d4f4oa_, d4f4od_, d4f4og_, d4f4oj_ automated match to d1qpwb_ complexed with hem, nag, oxy |
PDB Entry: 4f4o (more details), 2.9 Å
SCOPe Domain Sequences for d4f4ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4f4ob_ a.1.1.2 (B:) Hemoglobin, beta-chain {Pig (Sus scrofa) [TaxId: 9823]}
vhlsaeekeavlglwgkvnvdevggealgrllvvypwtqrffesfgdlsnadavmgnpkv
kahgkkvlqsfsdglkhldnlkgtfaklselhcdqlhvdpenfrllgnvivvvlarrlgh
dfnpnvqaafqkvvagvanalahkyh
Timeline for d4f4ob_: