Lineage for d1e96b_ (1e96 B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 6046Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)
  4. 6222Superfamily a.118.8: Tetratricopeptide repeat (TPR) [48452] (1 family) (S)
  5. 6223Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (5 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 6229Protein Neutrophil cytosolic factor 2 (NCF-2, p67-phox) [48460] (1 species)
  7. 6230Species Human (Homo sapiens) [TaxId:9606] [48461] (1 PDB entry)
  8. 6231Domain d1e96b_: 1e96 B: [19211]
    Other proteins in same PDB: d1e96a_

Details for d1e96b_

PDB Entry: 1e96 (more details), 2.4 Å

PDB Description: structure of the rac/p67phox complex

SCOP Domain Sequences for d1e96b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e96b_ a.118.8.1 (B:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens)}
slveaislwnegvlaadkkdwkgaldafsavqdphsricfnigcmytilknmteaekaft
rsinrdkhlavayfqrgmlyyqtekydlaikdlkealiqlrgnqlidykilglqfklfac
evlyniafmyakkeewkkaeeqlalatsmkseprhskidkamecvwkqklyepvvipvgk
lfrpn

SCOP Domain Coordinates for d1e96b_:

Click to download the PDB-style file with coordinates for d1e96b_.
(The format of our PDB-style files is described here.)

Timeline for d1e96b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1e96a_