SCOP 1.57: Domain d1e96b_: 1e96 B:

Lineage for d1e96b_ (1e96 B:)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (11 superfamilies)

4. Superfamily a.118.8: Tetratricopeptide repeat (TPR) [48452] (1 family)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (6 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Neutrophil cytosolic factor 2 (NCF-2, p67-phox) [48460] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48461] (2 PDB entries)

8. Domain d1e96b_: 1e96 B: [19211]
   Other proteins in same PDB: d1e96a_

Details for d1e96b_

PDB Entry: 1e96, 2.4 Å

PDB Description: structure of the rac/p67phox complex

SCOP Domain Sequences for d1e96b_:

Sequence; same for both SEQRES and ATOM records:

>d1e96b_ a.118.8.1 (B:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens)}
slveaislwnegvlaadkkdwkgaldafsavqdphsricfnigcmytilknmteaekaft
rsinrdkhlavayfqrgmlyyqtekydlaikdlkealiqlrgnqlidykilglqfklfac
evlyniafmyakkeewkkaeeqlalatsmkseprhskidkamecvwkqklyepvvipvgk
lfrpn

Timeline for d1e96b_:

• d1e96b_ first appeared (with stable ids) in SCOP 1.55
  
• d1e96b_ appears in SCOP 1.59
  
• d1e96b_ appears in the current release, SCOPe 2.08