Lineage for d1e96b_ (1e96 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726650Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 2726739Protein Neutrophil cytosolic factor 2 (NCF-2, p67-phox) [48460] (1 species)
  7. 2726740Species Human (Homo sapiens) [TaxId:9606] [48461] (2 PDB entries)
  8. 2726742Domain d1e96b_: 1e96 B: [19211]
    Other proteins in same PDB: d1e96a1, d1e96a2
    complexed with gtp, mg
    has additional insertions and/or extensions that are not grouped together

Details for d1e96b_

PDB Entry: 1e96 (more details), 2.4 Å

PDB Description: structure of the rac/p67phox complex
PDB Compounds: (B:) neutrophil cytosol factor 2 (ncf-2) tpr domain, residues 1-203

SCOPe Domain Sequences for d1e96b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e96b_ a.118.8.1 (B:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}
slveaislwnegvlaadkkdwkgaldafsavqdphsricfnigcmytilknmteaekaft
rsinrdkhlavayfqrgmlyyqtekydlaikdlkealiqlrgnqlidykilglqfklfac
evlyniafmyakkeewkkaeeqlalatsmkseprhskidkamecvwkqklyepvvipvgk
lfrpn

SCOPe Domain Coordinates for d1e96b_:

Click to download the PDB-style file with coordinates for d1e96b_.
(The format of our PDB-style files is described here.)

Timeline for d1e96b_: