| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.8: TPR-like [48452] (11 families) ![]() |
| Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
| Protein Neutrophil cytosolic factor 2 (NCF-2, p67-phox) [48460] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [48461] (2 PDB entries) |
| Domain d1e96b_: 1e96 B: [19211] Other proteins in same PDB: d1e96a1, d1e96a2 complexed with gtp, mg has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1e96 (more details), 2.4 Å
SCOPe Domain Sequences for d1e96b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e96b_ a.118.8.1 (B:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}
slveaislwnegvlaadkkdwkgaldafsavqdphsricfnigcmytilknmteaekaft
rsinrdkhlavayfqrgmlyyqtekydlaikdlkealiqlrgnqlidykilglqfklfac
evlyniafmyakkeewkkaeeqlalatsmkseprhskidkamecvwkqklyepvvipvgk
lfrpn
Timeline for d1e96b_: