SCOPe 2.08: Domain d3rl7e_: 3rl7 E:

Lineage for d3rl7e_ (3rl7 E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187785] (51 PDB entries)

8. Domain d3rl7e_: 3rl7 E: [185010]
   Other proteins in same PDB: d3rl7b2, d3rl7d2, d3rl7f2
   automated match to d1zoka1

Details for d3rl7e_

PDB Entry: 3rl7, 2.3 Å

PDB Description: crystal structure of hdlg1-pdz1 complexed with apc

PDB Compounds: (E:) Disks large homolog 1

SCOPe Domain Sequences for d3rl7e_:

Sequence, based on SEQRES records:

>d3rl7e_ b.36.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeyeeitlergnsglgfsiaggtdnphigddssifitkiitggaaaqdgrlrvndcilrv
nevdvrdvthskavealkeagsivrlyvkrr

Sequence, based on observed residues (ATOM records):

>d3rl7e_ b.36.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yeyeeitlergnsglgfsiaggssifitkiitggaaaqdgrlrvndcilrvnevdvrdvt
hskavealkeagsivrlyvkrr

Timeline for d3rl7e_:

• d3rl7e_ first appeared in SCOPe 2.01
  
• d3rl7e_ appears in SCOPe 2.07