PDB entry 3rl7

View 3rl7 on RCSB PDB site
Description: Crystal structure of hDLG1-PDZ1 complexed with APC
Class: membrane protein/signaling protein
Keywords: PDZ-ligand complex, MEMBRANE PROTEIN-SIGNALING PROTEIN complex
Deposited on 2011-04-19, released 2011-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disks large homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Dlg1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rl7a_
  • Chain 'B':
    Compound: Disks large homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Dlg1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12959 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.07: d3rl7b1, d3rl7b2
  • Chain 'C':
    Compound: Disks large homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Dlg1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rl7c_
  • Chain 'D':
    Compound: Disks large homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Dlg1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12959 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.07: d3rl7d1, d3rl7d2
  • Chain 'E':
    Compound: Disks large homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Dlg1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3rl7e_
  • Chain 'F':
    Compound: Disks large homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: Dlg1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q12959 (9-End)
      • expression tag (8)
    Domains in SCOPe 2.07: d3rl7f1, d3rl7f2
  • Chain 'G':
    Compound: 11-mer peptide from Adenomatous polyposis coli protein
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 11-mer peptide from Adenomatous polyposis coli protein
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: 11-mer peptide from Adenomatous polyposis coli protein
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: 11-mer peptide from Adenomatous polyposis coli protein
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: 11-mer peptide from Adenomatous polyposis coli protein
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: 11-mer peptide from Adenomatous polyposis coli protein
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3rl7A (A:)
    mghhhhhhmyeyeeitlergnsglgfsiaggtdnphigddssifitkiitggaaaqdgrl
    rvndcilrvnevdvrdvthskavealkeagsivrlyvkrrkpvseki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rl7A (A:)
    yeyeeitlergnsglgfsiaggtdnphigddssifitkiitggaaaqdgrlrvndcilrv
    nevdvrdvthskavealkeagsivrlyvkr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3rl7B (B:)
    mghhhhhhmyeyeeitlergnsglgfsiaggtdnphigddssifitkiitggaaaqdgrl
    rvndcilrvnevdvrdvthskavealkeagsivrlyvkrrkpvseki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rl7B (B:)
    myeyeeitlergnsglgfsiaggtdnphdssifitkiitggaaaqdgrlrvndcilrvne
    vdvrdvthskavealkeagsivrlyvkrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3rl7C (C:)
    mghhhhhhmyeyeeitlergnsglgfsiaggtdnphigddssifitkiitggaaaqdgrl
    rvndcilrvnevdvrdvthskavealkeagsivrlyvkrrkpvseki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rl7C (C:)
    yeyeeitlergnsglgfsiaggtdnpdssifitkiitggaaaqdgrlrvndcilrvnevd
    vrdvthskavealkeagsivrlyvkrr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3rl7D (D:)
    mghhhhhhmyeyeeitlergnsglgfsiaggtdnphigddssifitkiitggaaaqdgrl
    rvndcilrvnevdvrdvthskavealkeagsivrlyvkrrkpvseki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rl7D (D:)
    myeyeeitlergnsglgfsiaggtdnphigddssifitkiitggaaaqdgrlrvndcilr
    vnevdvrdvthskavealkeagsivrlyvkrr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3rl7E (E:)
    mghhhhhhmyeyeeitlergnsglgfsiaggtdnphigddssifitkiitggaaaqdgrl
    rvndcilrvnevdvrdvthskavealkeagsivrlyvkrrkpvseki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rl7E (E:)
    yeyeeitlergnsglgfsiaggssifitkiitggaaaqdgrlrvndcilrvnevdvrdvt
    hskavealkeagsivrlyvkrr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3rl7F (F:)
    mghhhhhhmyeyeeitlergnsglgfsiaggtdnphigddssifitkiitggaaaqdgrl
    rvndcilrvnevdvrdvthskavealkeagsivrlyvkrrkpvseki
    

    Sequence, based on observed residues (ATOM records): (download)
    >3rl7F (F:)
    myeyeeitlergnsglgfsiaggtdnphigddssifitkiitggaaaqdgrlrvndcilr
    vnevdvrdvthskavealkeagsivrlyvkr
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.