Class b: All beta proteins [48724] (180 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein automated matches [190055] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187785] (51 PDB entries) |
Domain d3rl7d1: 3rl7 D:220-310 [185009] Other proteins in same PDB: d3rl7b2, d3rl7d2, d3rl7f2 automated match to d1zoka1 |
PDB Entry: 3rl7 (more details), 2.3 Å
SCOPe Domain Sequences for d3rl7d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rl7d1 b.36.1.1 (D:220-310) automated matches {Human (Homo sapiens) [TaxId: 9606]} yeyeeitlergnsglgfsiaggtdnphigddssifitkiitggaaaqdgrlrvndcilrv nevdvrdvthskavealkeagsivrlyvkrr
Timeline for d3rl7d1: