SCOPe 2.08: Domain d1efra1: 1efr A:380-510

Lineage for d1efra1 (1efr A:380-510)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families)

5. Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins)

6. Protein F1 ATP synthase alpha subunit, domain 3 [88886] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88893] (15 PDB entries)
   Uniprot P19483

8. Domain d1efra1: 1efr A:380-510 [18299]
   Other proteins in same PDB: d1efra2, d1efra3, d1efrb2, d1efrb3, d1efrc2, d1efrc3, d1efrd1, d1efrd2, d1efrd3, d1efre1, d1efre2, d1efre3, d1efrf1, d1efrf2, d1efrf3, d1efrg_
   complexed with adp, anp, mg

Details for d1efra1

PDB Entry: 1efr, 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the peptide antibiotic efrapeptin

PDB Compounds: (A:) bovine mitochondrial f1-ATPase subunit alpha

SCOPe Domain Sequences for d1efra1:

Sequence; same for both SEQRES and ATOM records:

>d1efra1 a.69.1.1 (A:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]}
tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie
eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke
ivtnflagfea

Timeline for d1efra1:

• d1efra1 first appeared (with stable ids) in SCOP 1.55
  
• d1efra1 appears in SCOPe 2.07