![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
![]() | Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) ![]() automatically mapped to Pfam PF02874 |
![]() | Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (3 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
![]() | Protein F1 ATP synthase alpha subunit, domain 1 [88672] (5 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [88673] (15 PDB entries) Uniprot P19483 |
![]() | Domain d1efrc2: 1efr C:19-94 [26466] Other proteins in same PDB: d1efra1, d1efra3, d1efrb1, d1efrb3, d1efrc1, d1efrc3, d1efrd1, d1efrd2, d1efrd3, d1efre1, d1efre2, d1efre3, d1efrf1, d1efrf2, d1efrf3, d1efrg_ complexed with adp, anp, mg |
PDB Entry: 1efr (more details), 3.1 Å
SCOPe Domain Sequences for d1efrc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1efrc2 b.49.1.1 (C:19-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} adtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgn dklikegdivkrtgai
Timeline for d1efrc2: