SCOPe 2.08: Domain d1efre3: 1efr E:82-357

Lineage for d1efre3 (1efr E:82-357)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.11: RecA protein-like (ATPase-domain) [52670] (22 proteins)
   core: mixed beta-sheet of 8 strands, order 32451678; strand 7 is antiparallel to the rest

6. Protein Central domain of beta subunit of F1 ATP synthase [88779] (5 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88780] (18 PDB entries)
   Uniprot P00829

8. Domain d1efre3: 1efr E:82-357 [32348]
   Other proteins in same PDB: d1efra1, d1efra2, d1efra3, d1efrb1, d1efrb2, d1efrb3, d1efrc1, d1efrc2, d1efrc3, d1efrd1, d1efrd2, d1efre1, d1efre2, d1efrf1, d1efrf2, d1efrg_
   complexed with adp, anp, mg

Details for d1efre3

PDB Entry: 1efr, 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the peptide antibiotic efrapeptin

PDB Compounds: (E:) bovine mitochondrial f1-ATPase subunit beta

SCOPe Domain Sequences for d1efre3:

Sequence; same for both SEQRES and ATOM records:

>d1efre3 c.37.1.11 (E:82-357) Central domain of beta subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]}
iripvgpetlgrimnvigepidergpiktkqfaaihaeapefvemsveqeilvtgikvvd
llapyakggkiglfggagvgktvlimelinnvakahggysvfagvgertregndlyhemi
esgvinlkdatskvalvygqmneppgararvaltgltvaeyfrdqegqdvllfidnifrf
tqagsevsallgripsavgyqptlatdmgtmqeritttkkgsitsvqaiyvpaddltdpa
pattfahldattvlsraiaelgiypavdpldstsri

Timeline for d1efre3:

• d1efre3 first appeared (with stable ids) in SCOP 1.55
  
• d1efre3 appears in SCOPe 2.07