SCOPe 2.08: Domain d1efrg_: 1efr G:

Lineage for d1efrg_ (1efr G:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest

4. Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families)
   contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold

5. Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein)
   automatically mapped to Pfam PF00231

6. Protein F1 ATP synthase gamma subunit [52945] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [52946] (19 PDB entries)
   Uniprot P05631

8. Domain d1efrg_: 1efr G: [33163]
   Other proteins in same PDB: d1efra1, d1efra2, d1efra3, d1efrb1, d1efrb2, d1efrb3, d1efrc1, d1efrc2, d1efrc3, d1efrd1, d1efrd2, d1efrd3, d1efre1, d1efre2, d1efre3, d1efrf1, d1efrf2, d1efrf3
   core domain is disordered; only coiled coil part is visible
   complexed with adp, anp, mg
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1efrg_

PDB Entry: 1efr, 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the peptide antibiotic efrapeptin

PDB Compounds: (G:) bovine mitochondrial f1-ATPase subunit gamma

SCOPe Domain Sequences for d1efrg_:

Sequence, based on SEQRES records:

>d1efrg_ c.49.2.1 (G:) F1 ATP synthase gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvygvgslalyekadiktp
edkkkhliigvssdrglcgaihssvakqmkseaanlaaagkevkiigvgdkirsilhrth
sdqflvtfkevgrrpptfgdasvialellnsgyefdegsiifnrfrsvisykteekpifs
ldtissaesmsiyddidadvlrnyqeyslaniiyyslkesttseqsarmtamdnasknas
emidkltltfnrtrqavitkelieiisgaaal

Sequence, based on observed residues (ATOM records):

>d1efrg_ c.49.2.1 (G:) F1 ATP synthase gamma subunit {Cow (Bos taurus) [TaxId: 9913]}
atlkditrrlksikniqkitksmkmvaaakyaraerelkparvylcgaihssvakqmkla
niiyyslkesttseqsarmtamdnasknasemidkltltfnrtrqavitkelieiisgaa
al

Timeline for d1efrg_:

• d1efrg_ first appeared (with stable ids) in SCOP 1.55
  
• d1efrg_ appears in SCOPe 2.07