Lineage for d1efrf2 (1efr F:9-81)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2798608Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2798609Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (3 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 2798680Protein F1 ATP synthase beta subunit, domain 1 [88677] (5 species)
  7. 2798729Species Cow (Bos taurus) [TaxId:9913] [88678] (18 PDB entries)
    Uniprot P00829
  8. 2798789Domain d1efrf2: 1efr F:9-81 [26469]
    Other proteins in same PDB: d1efra1, d1efra2, d1efra3, d1efrb1, d1efrb2, d1efrb3, d1efrc1, d1efrc2, d1efrc3, d1efrd1, d1efrd3, d1efre1, d1efre3, d1efrf1, d1efrf3, d1efrg_
    complexed with adp, anp, mg

Details for d1efrf2

PDB Entry: 1efr (more details), 3.1 Å

PDB Description: bovine mitochondrial f1-atpase complexed with the peptide antibiotic efrapeptin
PDB Compounds: (F:) bovine mitochondrial f1-ATPase subunit beta

SCOPe Domain Sequences for d1efrf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efrf2 b.49.1.1 (F:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOPe Domain Coordinates for d1efrf2:

Click to download the PDB-style file with coordinates for d1efrf2.
(The format of our PDB-style files is described here.)

Timeline for d1efrf2: