SCOP 1.63: Domain d1trla_: 1trl A:

Lineage for d1trla_ (1trl A:)

1. Root: SCOP 1.63

2. Class j: Peptides [58231] (101 folds)

3. Fold j.78: C-terminal fragment of thermolysin [63387] (1 superfamily)

4. Superfamily j.78.1: C-terminal fragment of thermolysin [63388] (1 family)

5. Family j.78.1.1: C-terminal fragment of thermolysin [63389] (1 protein)

6. Protein C-terminal fragment of thermolysin [63390] (1 species)

7. Species Bacillus thermoproteolyticus [TaxId:1427] [63391] (1 PDB entry)

8. Domain d1trla_: 1trl A: [18263]

Details for d1trla_

PDB Entry: 1trl

PDB Description: nmr solution structure of the c-terminal fragment 255-316 of thermolysin: a dimer formed by subunits having the native structure

SCOP Domain Sequences for d1trla_:

Sequence; same for both SEQRES and ATOM records:

>d1trla_ j.78.1.1 (A:) C-terminal fragment of thermolysin {Bacillus thermoproteolyticus}
vvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygstsqevasvkqafdavg
vk

Timeline for d1trla_:

• d1trla_ first appeared (with stable ids) in SCOP 1.55
  
• d1trla_ appears in SCOP 1.61
  
• d1trla_ appears in SCOP 1.65
  
• d1trla_ appears in the current release, SCOPe 2.08