PDB entry 1trl

View 1trl on RCSB PDB site
Description: nmr solution structure of the c-terminal fragment 255-316 of thermolysin: a dimer formed by subunits having the native structure
Deposited on 1994-09-02, released 1995-02-07
The last revision prior to the SCOP 1.63 freeze date was dated 1995-02-07, with a file datestamp of 1995-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1trla_
  • Chain 'B':
    Domains in SCOP 1.63: d1trlb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1trlA (A:)
vvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygstsqevasvkqafdavg
vk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1trlB (B:)
vvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygstsqevasvkqafdavg
vk