SCOP 1.63: Domain d1trlb_: 1trl B:

Lineage for d1trlb_ (1trl B:)

1. Root: SCOP 1.63

2. Class j: Peptides [58231] (101 folds)

3. Fold j.78: C-terminal fragment of thermolysin [63387] (1 superfamily)

4. Superfamily j.78.1: C-terminal fragment of thermolysin [63388] (1 family)

5. Family j.78.1.1: C-terminal fragment of thermolysin [63389] (1 protein)

6. Protein C-terminal fragment of thermolysin [63390] (1 species)

7. Species Bacillus thermoproteolyticus [TaxId:1427] [63391] (1 PDB entry)

8. Domain d1trlb_: 1trl B: [18264]
   residues 255-316

Details for d1trlb_

PDB Entry: 1trl

PDB Description: nmr solution structure of the c-terminal fragment 255-316 of thermolysin: a dimer formed by subunits having the native structure

SCOP Domain Sequences for d1trlb_:

Sequence; same for both SEQRES and ATOM records:

>d1trlb_ j.78.1.1 (B:) C-terminal fragment of thermolysin {Bacillus thermoproteolyticus}
vvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygstsqevasvkqafdavg
vk

Timeline for d1trlb_:

• d1trlb_ first appeared (with stable ids) in SCOP 1.55
  
• d1trlb_ appears in SCOP 1.61
  
• d1trlb_ appears in SCOP 1.65
  
• d1trlb_ appears in the current release, SCOPe 2.08