SCOP 1.55: Domain d1trla_: 1trl A:

Lineage for d1trla_ (1trl A:)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.67: Thermolysin-like metalloproteases, C-terminal domain [47900] (1 superfamily)

4. Superfamily a.67.1: Thermolysin-like metalloproteases, C-terminal domain [47901] (1 family)

5. Family a.67.1.1: Thermolysin-like metalloproteases, C-terminal domain [47902] (4 proteins)

6. Protein Thermolysin [47905] (1 species)

7. Species Bacillus thermoproteolyticus [TaxId:1427] [47906] (33 PDB entries)

8. Domain d1trla_: 1trl A: [18263]

Details for d1trla_

PDB Entry: 1trl

PDB Description: nmr solution structure of the c-terminal fragment 255-316 of thermolysin: a dimer formed by subunits having the native structure

SCOP Domain Sequences for d1trla_:

Sequence; same for both SEQRES and ATOM records:

>d1trla_ a.67.1.1 (A:) Thermolysin {Bacillus thermoproteolyticus}
vvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygstsqevasvkqafdavg
vk

Timeline for d1trla_:

• d1trla_ appears in SCOP 1.57
  
• d1trla_ appears in the current release, SCOPe 2.08