SCOP 1.55: Domain d2ezxb_: 2ezx B:

Lineage for d2ezxb_ (2ezx B:)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.60: SAM domain-like [47768] (10 superfamilies)

4. Superfamily a.60.5: Barrier-to-autointegration factor, BAF [47798] (1 family)

5. Family a.60.5.1: Barrier-to-autointegration factor, BAF [47799] (1 protein)

6. Protein Barrier-to-autointegration factor, BAF [47800] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47801] (5 PDB entries)

8. Domain d2ezxb_: 2ezx B: [17979]

Details for d2ezxb_

PDB Entry: 2ezx

PDB Description: solution structure of human barrier-to-autointegration factor baf, nmr, regularized mean structure

SCOP Domain Sequences for d2ezxb_:

Sequence; same for both SEQRES and ATOM records:

>d2ezxb_ a.60.5.1 (B:) Barrier-to-autointegration factor, BAF {Human (Homo sapiens)}
mttsqkhrdfvaepmgekpvgslagigevlgkkleergfdkayvvlgqflvlkkdedlfr
ewlkdtcganakqsrdcfgclrewcdafl

Timeline for d2ezxb_:

• d2ezxb_ appears in SCOP 1.57
  
• d2ezxb_ appears in the current release, SCOPe 2.08